PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_0D056C042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family YABBY
Protein Properties Length: 70aa    MW: 7348.54 Da    PI: 9.5252
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_0D056C042.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY42.72e-1327592254
                  YABBY 22 lavsvPstslfkvvtvrCGhCtsllsvnlakas 54
                           + vsvPs+slfk+vtvrCGhC+sll+v+++   
  Traes_1DL_0D056C042.1 27 VQVSVPSSSLFKTVTVRCGHCSSLLTVDMRGLL 59
                           67*************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.6E-122762IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
ASKRLSVCSS AAAAPPFKSI YREVTGVQVS VPSSSLFKTV TVRCGHCSSL LTVDMRGLLF  60
PTTTTTVVAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3302287e-59AY330228.1 Triticum aestivum YABBY protein (YAB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105231.12e-15yabby 9
TrEMBLW5ACP04e-43W5ACP0_WHEAT; Uncharacterized protein
STRINGGRMZM2G074543_P041e-16(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5164022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00180.29e-14YABBY family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]